(data stored in ACNUC7421 zone)

EMBL: CP000271.PE481

CP000271.PE481       Location/Qualifiers
FT   CDS             575254..576087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2543"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33449"
FT                   /db_xref="GOA:Q13R40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R40"
FT                   /protein_id="ABE33449.1"
FT                   /translation="MNYTLNLKAVVAMLLPLYGLLAVFFLWPLGVVGWSSVYEHAFTLR
FT                   GYEQALSSTLIHRVLGNTVIISVLATATSLVLGYIVALHLARMPAGKRAPYLVMVMLPF
FT                   WTSILVKSYAFTVVLGSAGIVAKLAGWLSGDAWHPDLMFSRTSVVIGMTNYLLPFMVLP
FT                   ILASLTTQNRNLKSAAELMGAGPAMIFTRITLPLSMPGVVAGVLMCLTLSMGMYITPAL
FT                   LGGPRDMMLANLIDFYTRQTLDWTLAAAIAMMLLVLSGALIGMLGRVQHGKEALV"
     MNYTLNLKAV VAMLLPLYGL LAVFFLWPLG VVGWSSVYEH AFTLRGYEQA LSSTLIHRVL        60
     GNTVIISVLA TATSLVLGYI VALHLARMPA GKRAPYLVMV MLPFWTSILV KSYAFTVVLG       120
     SAGIVAKLAG WLSGDAWHPD LMFSRTSVVI GMTNYLLPFM VLPILASLTT QNRNLKSAAE       180
     LMGAGPAMIF TRITLPLSMP GVVAGVLMCL TLSMGMYITP ALLGGPRDMM LANLIDFYTR       240
     QTLDWTLAAA IAMMLLVLSG ALIGMLGRVQ HGKEALV                                277
//

If you have problems or comments...

PBIL Back to PBIL home page