(data stored in ACNUC7421 zone)

EMBL: CP000271.PE482

CP000271.PE482       Location/Qualifiers
FT   CDS             576084..576935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2542"
FT                   /product="ABC spermidine/putrescine transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2542"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33450"
FT                   /db_xref="GOA:Q13R39"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R39"
FT                   /protein_id="ABE33450.1"
FT                   /translation="MMNTAAHVGKDLVQPEPKRRDRRAALRVLGSVGGWCGYLFLLLPS
FT                   LVIVPISFGGGSELTFPPRTFSFSLFQQFFADPAWWGACMTSVMVALLASAIAIAVGVP
FT                   GAYALARGHFPGKRVLETLAITPMLVPVVVLGLGIYKQFSALALVNTIGGLALAHAVLV
FT                   VPFVIIAVGSGLRHADASLEAVALVMGASRTRIFFQVVLPQIRASVAVSVLFAFLLSFD
FT                   EVVVAYFISGPQTTTLPVKMYSAIRWEVSPVLAAVSTLLTLISLLVCLGIMTLQRRDSD
FT                   TE"
     MMNTAAHVGK DLVQPEPKRR DRRAALRVLG SVGGWCGYLF LLLPSLVIVP ISFGGGSELT        60
     FPPRTFSFSL FQQFFADPAW WGACMTSVMV ALLASAIAIA VGVPGAYALA RGHFPGKRVL       120
     ETLAITPMLV PVVVLGLGIY KQFSALALVN TIGGLALAHA VLVVPFVIIA VGSGLRHADA       180
     SLEAVALVMG ASRTRIFFQV VLPQIRASVA VSVLFAFLLS FDEVVVAYFI SGPQTTTLPV       240
     KMYSAIRWEV SPVLAAVSTL LTLISLLVCL GIMTLQRRDS DTE                         283
//

If you have problems or comments...

PBIL Back to PBIL home page