(data stored in ACNUC7421 zone)

EMBL: CP000271.PE488

CP000271.PE488       Location/Qualifiers
FT   CDS             complement(583789..585372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2535"
FT                   /product="Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2535"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33456"
FT                   /db_xref="GOA:Q13R33"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R33"
FT                   /protein_id="ABE33456.1"
FT                   /translation="MRKEPRLRPKTAIPSTNDGTPAPDLEQFRLRRFLESLDDSELERH
FT                   EAPVDLADVAAIMEGNPRAVWFGRVSGSTASLAGSVAASRTRLAQAFGTTPQRLLDTVR
FT                   ERLRTKGRLVEVSREEAPVQQIVLTGDDCDFTALPVHLQHELDGAPYISASIDFAIDPD
FT                   TGWTNVGIRRLMLRGRRTAGIDLVAPSDLRAIAIGHAKRGERTPIAFAVGTHPIDHVGA
FT                   TMRIPADELELVAALRGTAMGVVKCITNDLLVPADAEFILEGYLDERGHAEPEGPYGEF
FT                   LGYYGGVKTNPVFHLTAITHRRDAVFQTCTIGGRSMACTDTAQLAALRTEVTVWRALET
FT                   AVREVNAVYANPATGGMFNVRIAMQQRVPGEARNAIAAVFASLANVKHVFVVDPDIDVF
FT                   SDEQMDWALATRFQADRDLVLQDGMRAMPLDPSLLGATKTAKAGFDLTLPLLAPGAQRD
FT                   LEHRVPTPPAYQGARFDSLEAALEDGPKRFSELMAAAGTRDGREVVRWLEDIAPRRAIA
FT                   RDAEGRYTFA"
     MRKEPRLRPK TAIPSTNDGT PAPDLEQFRL RRFLESLDDS ELERHEAPVD LADVAAIMEG        60
     NPRAVWFGRV SGSTASLAGS VAASRTRLAQ AFGTTPQRLL DTVRERLRTK GRLVEVSREE       120
     APVQQIVLTG DDCDFTALPV HLQHELDGAP YISASIDFAI DPDTGWTNVG IRRLMLRGRR       180
     TAGIDLVAPS DLRAIAIGHA KRGERTPIAF AVGTHPIDHV GATMRIPADE LELVAALRGT       240
     AMGVVKCITN DLLVPADAEF ILEGYLDERG HAEPEGPYGE FLGYYGGVKT NPVFHLTAIT       300
     HRRDAVFQTC TIGGRSMACT DTAQLAALRT EVTVWRALET AVREVNAVYA NPATGGMFNV       360
     RIAMQQRVPG EARNAIAAVF ASLANVKHVF VVDPDIDVFS DEQMDWALAT RFQADRDLVL       420
     QDGMRAMPLD PSLLGATKTA KAGFDLTLPL LAPGAQRDLE HRVPTPPAYQ GARFDSLEAA       480
     LEDGPKRFSE LMAAAGTRDG REVVRWLEDI APRRAIARDA EGRYTFA                     527
//

If you have problems or comments...

PBIL Back to PBIL home page