(data stored in ACNUC7421 zone)

EMBL: CP000271.PE49

CP000271.PE49        Location/Qualifiers
FT   CDS             56098..56544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2978"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2978"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC2"
FT                   /protein_id="ABE33017.1"
FT                   /translation="MIEKQDVFGVSDETQSFLIRAPCLRHAGDRRRGCAGRLQQQRAAV
FT                   PVGRPRHDAGAMPGWFRLLLAAGRRELRRRIRRRAPVDRERHAQPDLRLPGEITGRAGR
FT                   ARPARSASQAFLRSARRATTSAGVSIAASISLVLAEWLIRASSS"
     MIEKQDVFGV SDETQSFLIR APCLRHAGDR RRGCAGRLQQ QRAAVPVGRP RHDAGAMPGW        60
     FRLLLAAGRR ELRRRIRRRA PVDRERHAQP DLRLPGEITG RAGRARPARS ASQAFLRSAR       120
     RATTSAGVSI AASISLVLAE WLIRASSS                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page