(data stored in ACNUC7421 zone)

EMBL: CP000271.PE491

CP000271.PE491       Location/Qualifiers
FT   CDS             complement(588564..589073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2532"
FT                   /product="Carbon-monoxide dehydrogenase small subunit"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33459"
FT                   /db_xref="GOA:Q13R30"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R30"
FT                   /protein_id="ABE33459.1"
FT                   /translation="MAEVQLRVNGVDVERDVPDQTLLVEFLRETLRLTGTHVGCDTSQC
FT                   GACTVNLDGVSVKSCTVLAAQASGGAVTTVEGLRADQDAPLHPVQNAFVQCHGLQCGFC
FT                   TPGMIMSVDFYLRRPPKLDEESICHALEGNICRCTGYVNIIEAVRHAAHDLYPALAGAT
FT                   AEGSQS"
     MAEVQLRVNG VDVERDVPDQ TLLVEFLRET LRLTGTHVGC DTSQCGACTV NLDGVSVKSC        60
     TVLAAQASGG AVTTVEGLRA DQDAPLHPVQ NAFVQCHGLQ CGFCTPGMIM SVDFYLRRPP       120
     KLDEESICHA LEGNICRCTG YVNIIEAVRH AAHDLYPALA GATAEGSQS                   169
//

If you have problems or comments...

PBIL Back to PBIL home page