(data stored in ACNUC7421 zone)

EMBL: CP000271.PE492

CP000271.PE492       Location/Qualifiers
FT   CDS             complement(589114..589599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2531"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2531"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33460"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R29"
FT                   /protein_id="ABE33460.1"
FT                   /translation="MEFTGSQTIAATREQVWKGLNDAAVLQACVPGCEEFIAQNEDEYK
FT                   AVVVASVGPVKARFKGTLALSERNGPNGYRIAGQGEGGIAGFGKMTATVTLADADQGGT
FT                   LLTYVAEAQVGGKLAQIGSRLVTSVANKLAAEFFKRFNATMSAGPDATEAANAGTAH"
     MEFTGSQTIA ATREQVWKGL NDAAVLQACV PGCEEFIAQN EDEYKAVVVA SVGPVKARFK        60
     GTLALSERNG PNGYRIAGQG EGGIAGFGKM TATVTLADAD QGGTLLTYVA EAQVGGKLAQ       120
     IGSRLVTSVA NKLAAEFFKR FNATMSAGPD ATEAANAGTA H                           161
//

If you have problems or comments...

PBIL Back to PBIL home page