(data stored in ACNUC7421 zone)

EMBL: CP000271.PE493

CP000271.PE493       Location/Qualifiers
FT   CDS             complement(589621..590439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2530"
FT                   /product="Putative carbon monoxide dehydrogenase, middle
FT                   subunit"
FT                   /EC_number="1.2.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33461"
FT                   /db_xref="GOA:Q13R28"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R28"
FT                   /protein_id="ABE33461.1"
FT                   /translation="MYETTYLRAASLDEAVAWLREHEEARPLSGGMTLIPTLKQRLAAP
FT                   SHLVDLTRIDALRGVSVEGNVLRVGALTRHAEVAASPVVASAIPALAQLAGVIADPQVR
FT                   NRGTMGGSVANNDPAADYPCAVLALGAQVITSQRRLAADDFFVDTFETALDAGELVVGF
FT                   EYPIPLRGAYAKFRQPASGYAVVGVFIAQFADAVRVAVTGAGASVFRWSEAEAALGADL
FT                   SDAALANLKMDDLALPDDDNGSAAYRAHLIETYTRRALQSLLAQPLRQPA"
     MYETTYLRAA SLDEAVAWLR EHEEARPLSG GMTLIPTLKQ RLAAPSHLVD LTRIDALRGV        60
     SVEGNVLRVG ALTRHAEVAA SPVVASAIPA LAQLAGVIAD PQVRNRGTMG GSVANNDPAA       120
     DYPCAVLALG AQVITSQRRL AADDFFVDTF ETALDAGELV VGFEYPIPLR GAYAKFRQPA       180
     SGYAVVGVFI AQFADAVRVA VTGAGASVFR WSEAEAALGA DLSDAALANL KMDDLALPDD       240
     DNGSAAYRAH LIETYTRRAL QSLLAQPLRQ PA                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page