(data stored in ACNUC7421 zone)

EMBL: CP000271.PE496

CP000271.PE496       Location/Qualifiers
FT   CDS             complement(592634..593164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2527"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2527"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33464"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R25"
FT                   /protein_id="ABE33464.1"
FT                   /translation="MSAVPPILGLHHFAWRCRNAEETRHFYEDILGLPLVHLIRLDRVP
FT                   STGEYCPYVHLFFEMADGANIAFFDLGDDTAAEPSPNTPPWVNHIALRLATLEQLEAMK
FT                   QRLVEHGVDVLGVTDHHFVRSIYFFDPNGFRLELTVPVAPAETLECYKMQARPALDAWA
FT                   EERKKAVSETPVA"
     MSAVPPILGL HHFAWRCRNA EETRHFYEDI LGLPLVHLIR LDRVPSTGEY CPYVHLFFEM        60
     ADGANIAFFD LGDDTAAEPS PNTPPWVNHI ALRLATLEQL EAMKQRLVEH GVDVLGVTDH       120
     HFVRSIYFFD PNGFRLELTV PVAPAETLEC YKMQARPALD AWAEERKKAV SETPVA           176
//

If you have problems or comments...

PBIL Back to PBIL home page