(data stored in ACNUC7421 zone)

EMBL: CP000271.PE50

CP000271.PE50        Location/Qualifiers
FT   CDS             complement(56883..57143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2977"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33018"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SC1"
FT                   /protein_id="ABE33018.1"
FT                   /translation="MTLAAAHRCRSSAFLPFLQREERGVEPFDAARLRRHPHRAGNGIN
FT                   TAAPIGQRDSVFSGDMRDYVFKMFNIFFELVMIHCFPRITR"
     MTLAAAHRCR SSAFLPFLQR EERGVEPFDA ARLRRHPHRA GNGINTAAPI GQRDSVFSGD        60
     MRDYVFKMFN IFFELVMIHC FPRITR                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page