(data stored in ACNUC7421 zone)

EMBL: CP000271.PE501

CP000271.PE501       Location/Qualifiers
FT   CDS             598390..599823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2522"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2522"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33469"
FT                   /db_xref="GOA:Q13R20"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R20"
FT                   /protein_id="ABE33469.1"
FT                   /translation="MTQPRTLYDRIFDAHVVRTDADGTTLLYIDRHLLNEVTSPQAFES
FT                   LRREGRPVWRPQANLAVADHNVPTTDRRLGIADPVSRIQVDVLRENCERSGIVHYGMDD
FT                   ARQGIVHVVGPELGCTLPGMTIVCGDSHTSTHGALGALAFGIGTSEIEHVLGTQTLITR
FT                   RSRTMRMTLDGVLPPGCTAKDVALAVIGALGTAGGTGYAIEFAGPVVRALSMEGRMTLC
FT                   NMSIEAGARAGLIAVDETTLDYCRTRPHAPQGETWELSARVWRALRSDDDARFDAECSL
FT                   DVSTLAPQVTWGTSPEMVTGIDGRVPDPLDIHDAGRRASWQRALDYMGLDAGTRIDTIA
FT                   IDKVFIGSCTNGRLEDLRAAADILRATGGRIASNVRLALAVPGSQQVKRDAEAEGLHDV
FT                   FIAAGFEWREPGCSMCLAMNPDRLEPGERVASTSNRNFEGRQGAGGRSHLVSPAMAAAA
FT                   ALAGRFADVRPFASGMGGL"
     MTQPRTLYDR IFDAHVVRTD ADGTTLLYID RHLLNEVTSP QAFESLRREG RPVWRPQANL        60
     AVADHNVPTT DRRLGIADPV SRIQVDVLRE NCERSGIVHY GMDDARQGIV HVVGPELGCT       120
     LPGMTIVCGD SHTSTHGALG ALAFGIGTSE IEHVLGTQTL ITRRSRTMRM TLDGVLPPGC       180
     TAKDVALAVI GALGTAGGTG YAIEFAGPVV RALSMEGRMT LCNMSIEAGA RAGLIAVDET       240
     TLDYCRTRPH APQGETWELS ARVWRALRSD DDARFDAECS LDVSTLAPQV TWGTSPEMVT       300
     GIDGRVPDPL DIHDAGRRAS WQRALDYMGL DAGTRIDTIA IDKVFIGSCT NGRLEDLRAA       360
     ADILRATGGR IASNVRLALA VPGSQQVKRD AEAEGLHDVF IAAGFEWREP GCSMCLAMNP       420
     DRLEPGERVA STSNRNFEGR QGAGGRSHLV SPAMAAAAAL AGRFADVRPF ASGMGGL          477
//

If you have problems or comments...

PBIL Back to PBIL home page