(data stored in ACNUC7421 zone)

EMBL: CP000271.PE502

CP000271.PE502       Location/Qualifiers
FT   CDS             599823..600455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2521"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2521"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33470"
FT                   /db_xref="GOA:Q13R19"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R19"
FT                   /protein_id="ABE33470.1"
FT                   /translation="MEPLVCHEGLVVPLDRDNVDTDAIIPKQFMKSIARTGFGPYLFDE
FT                   WRYRDPGHYGKPAAERTPEPGFALNQQRYAGASVLLTRRNFGCGSSREHAPWALHQFGF
FT                   RVLVAESFADIFFNNCCKNGLLPVRLDAALIGRLMETVEAAHGYRLRVDLAAQTLTAPD
FT                   GECWRFDIPPALRTLLLEGLDETGATLAFADAIRAFEAVQLERSPWL"
     MEPLVCHEGL VVPLDRDNVD TDAIIPKQFM KSIARTGFGP YLFDEWRYRD PGHYGKPAAE        60
     RTPEPGFALN QQRYAGASVL LTRRNFGCGS SREHAPWALH QFGFRVLVAE SFADIFFNNC       120
     CKNGLLPVRL DAALIGRLME TVEAAHGYRL RVDLAAQTLT APDGECWRFD IPPALRTLLL       180
     EGLDETGATL AFADAIRAFE AVQLERSPWL                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page