(data stored in ACNUC7421 zone)

EMBL: CP000271.PE507

CP000271.PE507       Location/Qualifiers
FT   CDS             606637..607044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2516"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2516"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33475"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R14"
FT                   /protein_id="ABE33475.1"
FT                   /translation="MTIDEAQQLVSRGPYLNWLGLEVLDLGADTITVKAKWRPEWVANP
FT                   TLGQTHGGILAALIDFAADFSLLNSLGHPVPTIDMRVDYHRLTKQCDLIAKGRVIKLGR
FT                   QFSICEAQIFDGSNLLIASGRGAYITAPKES"
     MTIDEAQQLV SRGPYLNWLG LEVLDLGADT ITVKAKWRPE WVANPTLGQT HGGILAALID        60
     FAADFSLLNS LGHPVPTIDM RVDYHRLTKQ CDLIAKGRVI KLGRQFSICE AQIFDGSNLL       120
     IASGRGAYIT APKES                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page