(data stored in ACNUC7421 zone)

EMBL: CP000271.PE508

CP000271.PE508       Location/Qualifiers
FT   CDS             607122..607604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2515"
FT                   /product="putative tripartite tricarboxylate
FT                   transporter(TTT) family, TctB (4TM) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33476"
FT                   /db_xref="GOA:Q13R13"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R13"
FT                   /protein_id="ABE33476.1"
FT                   /translation="MSNGRERRFVTEYTRDYYGGALMLLVGLAAAFQGSRYGIGSMTHM
FT                   KAGFYPVVLGVILAILGVIIAGSATRVPSGDTEDEAQPSEWRGWICIVSSILAFLLLGK
FT                   FGGLLPASFAIVFISALGDRDNSVRAALIVATAISAVSVVLFWWALQLQFPLFSWG"
     MSNGRERRFV TEYTRDYYGG ALMLLVGLAA AFQGSRYGIG SMTHMKAGFY PVVLGVILAI        60
     LGVIIAGSAT RVPSGDTEDE AQPSEWRGWI CIVSSILAFL LLGKFGGLLP ASFAIVFISA       120
     LGDRDNSVRA ALIVATAISA VSVVLFWWAL QLQFPLFSWG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page