(data stored in ACNUC7421 zone)

EMBL: CP000271.PE509

CP000271.PE509       Location/Qualifiers
FT   CDS             607607..609202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2514"
FT                   /product="putative tripartite tricarboxylate
FT                   transporter(TTT) family, TctA (12TM) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2514"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33477"
FT                   /db_xref="GOA:Q13R12"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R12"
FT                   /protein_id="ABE33477.1"
FT                   /translation="MVVQSLTDLWQGFGVALEWHNLMWSFFGVVVGNLIGVLPGMGPLS
FT                   AISLLLPLTYSMHPVPAILMLAGVFYGSQYGGAIGAILLNLPCHPPHAVTCLDGYPLTR
FT                   QGKGGTALGITMISSFFAASVGIIVMIFLSPVLVNVAFKFGPSELFSIMLLGLLAGGTM
FT                   SSGSSVKGVAMTVFGMLIGVAGIDINSGAIRFTFGFPELADGVQLVALALGLFGVAEFL
FT                   RNVNRMHVVGSTAKVRLRDMRPSRAELKQSFWPMVRGTGIGTLFGAMPGTGPTITTFIA
FT                   YAVEKRISNSPERFGKGALEGVAAPEASSHSKTQVDFIPTMSLGIPGDPIMALLLGALL
FT                   IHGIQPGPLLISKHADIFWGLVASFWIGNVLLVLLNVPLIQLWVKVLQVPYRFLYPSAL
FT                   LFIAVGVYSTDNSLFEVGEVLLFGVVGAVLLALEFPVAPILLGYVLGPMIEENFRRTLL
FT                   LSHGHLSAFILHPISAVFIAASAILIAAQVYFAVLARIRKRKLRELLPEPPNMEQSQSA
FT                   RERELLRGDANQHS"
     MVVQSLTDLW QGFGVALEWH NLMWSFFGVV VGNLIGVLPG MGPLSAISLL LPLTYSMHPV        60
     PAILMLAGVF YGSQYGGAIG AILLNLPCHP PHAVTCLDGY PLTRQGKGGT ALGITMISSF       120
     FAASVGIIVM IFLSPVLVNV AFKFGPSELF SIMLLGLLAG GTMSSGSSVK GVAMTVFGML       180
     IGVAGIDINS GAIRFTFGFP ELADGVQLVA LALGLFGVAE FLRNVNRMHV VGSTAKVRLR       240
     DMRPSRAELK QSFWPMVRGT GIGTLFGAMP GTGPTITTFI AYAVEKRISN SPERFGKGAL       300
     EGVAAPEASS HSKTQVDFIP TMSLGIPGDP IMALLLGALL IHGIQPGPLL ISKHADIFWG       360
     LVASFWIGNV LLVLLNVPLI QLWVKVLQVP YRFLYPSALL FIAVGVYSTD NSLFEVGEVL       420
     LFGVVGAVLL ALEFPVAPIL LGYVLGPMIE ENFRRTLLLS HGHLSAFILH PISAVFIAAS       480
     AILIAAQVYF AVLARIRKRK LRELLPEPPN MEQSQSARER ELLRGDANQH S                531
//

If you have problems or comments...

PBIL Back to PBIL home page