(data stored in ACNUC7421 zone)

EMBL: CP000271.PE513

CP000271.PE513       Location/Qualifiers
FT   CDS             613299..613658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2510"
FT                   /product="predicted sulfurylase small subunit,
FT                   molybdopterin cytosine dinucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2510"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33481"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R08"
FT                   /protein_id="ABE33481.1"
FT                   /translation="MNRVDLDVLKSSYRWLADGCRVLLVTVVGTWGSSPRPGGAMPAVR
FT                   ADGRVAGSVSGGCIEDDLIEQVRRNGIEQTRPQLAGYGVSVEKTRYVAASLVKVSGSGW
FT                   STGNVSGARAAPADA"
     MNRVDLDVLK SSYRWLADGC RVLLVTVVGT WGSSPRPGGA MPAVRADGRV AGSVSGGCIE        60
     DDLIEQVRRN GIEQTRPQLA GYGVSVEKTR YVAASLVKVS GSGWSTGNVS GARAAPADA        119
//

If you have problems or comments...

PBIL Back to PBIL home page