(data stored in ACNUC7421 zone)

EMBL: CP000271.PE515

CP000271.PE515       Location/Qualifiers
FT   CDS             615562..616524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2508"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2508"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33483"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R06"
FT                   /protein_id="ABE33483.1"
FT                   /translation="MAASSMLFQPRYAVANGVDSYPDKPVRMVVAYGVGGVADNIGRVL
FT                   AAGLTKALGRSVFVDNRGGGGGTIGATLVAKAAPDGYTILLTSPPMIAVAPLLLPDIYY
FT                   NPTRDFTPIGTFVTTPNILVVNNSLPVKTLADLVSYARGPARGDVSFASGGTGSTGDLS
FT                   GQILKRTANIDLIAVPYKSSALGFPDVIAGRVSMLFDSVPSTLGFIRAGQVRPIVVMSD
FT                   KRSPLLPAVPTAVEEGYPAATMQFWMGIEGPANMPPVIVARLNAALRTAMATPEVAKSM
FT                   ESLGAQPFLTSPQEFSALQDRDIAKYKPLIREIGLGAGD"
     MAASSMLFQP RYAVANGVDS YPDKPVRMVV AYGVGGVADN IGRVLAAGLT KALGRSVFVD        60
     NRGGGGGTIG ATLVAKAAPD GYTILLTSPP MIAVAPLLLP DIYYNPTRDF TPIGTFVTTP       120
     NILVVNNSLP VKTLADLVSY ARGPARGDVS FASGGTGSTG DLSGQILKRT ANIDLIAVPY       180
     KSSALGFPDV IAGRVSMLFD SVPSTLGFIR AGQVRPIVVM SDKRSPLLPA VPTAVEEGYP       240
     AATMQFWMGI EGPANMPPVI VARLNAALRT AMATPEVAKS MESLGAQPFL TSPQEFSALQ       300
     DRDIAKYKPL IREIGLGAGD                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page