(data stored in ACNUC7421 zone)

EMBL: CP000271.PE516

CP000271.PE516       Location/Qualifiers
FT   CDS             616598..616861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2507"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33484"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R05"
FT                   /protein_id="ABE33484.1"
FT                   /translation="MNEIRKHPLMNSVGNALGARRLPTAWLIRGAQRSAQRRARALMNE
FT                   SCYSLMFDWFAGLTAWGAVWESVVCPDESAQLMQHEVSEAFL"
     MNEIRKHPLM NSVGNALGAR RLPTAWLIRG AQRSAQRRAR ALMNESCYSL MFDWFAGLTA        60
     WGAVWESVVC PDESAQLMQH EVSEAFL                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page