(data stored in ACNUC7421 zone)

EMBL: CP000271.PE517

CP000271.PE517       Location/Qualifiers
FT   CDS             616858..617388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2506"
FT                   /product="Putative oxidoreductase, alpha subunit"
FT                   /EC_number="1.3.99.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2506"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33485"
FT                   /db_xref="GOA:Q13R04"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R04"
FT                   /protein_id="ABE33485.1"
FT                   /translation="MTTGITITVNGRQHAVQADPETPLVYVLRNELGLYATKFGCGVAQ
FT                   CGVCSVLLDGQEIRSCIMPVSMAAGHEITTLEGLGELWEQRKRTPGTSLHREPETTDLH
FT                   PIQEAWIKLQVPQCGYCQSGMMIQAVSLLNTNPQPTRSDIVASMQGHICRCGTHMRIIS
FT                   AIEQAADHMSKEG"
     MTTGITITVN GRQHAVQADP ETPLVYVLRN ELGLYATKFG CGVAQCGVCS VLLDGQEIRS        60
     CIMPVSMAAG HEITTLEGLG ELWEQRKRTP GTSLHREPET TDLHPIQEAW IKLQVPQCGY       120
     CQSGMMIQAV SLLNTNPQPT RSDIVASMQG HICRCGTHMR IISAIEQAAD HMSKEG           176
//

If you have problems or comments...

PBIL Back to PBIL home page