(data stored in ACNUC7421 zone)

EMBL: CP000271.PE518

CP000271.PE518       Location/Qualifiers
FT   CDS             617392..619662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2505"
FT                   /product="Putative oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33486"
FT                   /db_xref="GOA:Q13R03"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R03"
FT                   /protein_id="ABE33486.1"
FT                   /translation="MPRENLPSSPAGNVVSPGRRGFLKAGGALVVTFCIPVISSSATRA
FT                   DTFGKVPPEQLDSWIAVQQDGSVSAFTGRIDMGTGVETVFVQAVAEELDVPVSSVTFVM
FT                   GDTARTVDQGKSTASNNIARNLPPLRQAAAEARLALMDLAAARLGVPSQKLVVKDGVVS
FT                   VSGGGQSVSYGELVGGKRFDIRLGVKGDGNRTQLTGRAKLKDPKEFKVLGTSVPRVDIP
FT                   AKVQGKFKYVHDVVVDGMAHGTVVLPPARGMKLVSVNGFAQPVPGVVKVVTRGNFVGIV
FT                   AETEQAAVRARNALNVTWAPGTNENFDDMYGTIRKTPVIKDEIEGVVGNVRTAFANAAT
FT                   VVEGTYYLPVNSHGMMGPSCAVADFREGSLTLWSGSQWPDGTRRDVAGMLGMPIDKVRL
FT                   IWVQGSGSYGRLGVDDAAGDAALLSQAVGRPVRVQWQRADENQWSPFCPAAVIHVKAGL
FT                   DAQGKITAWEFENWTPGHSTAEQGNILAWRALGTNPGHKRLSGGADSPSYDIANINVVT
FT                   HYTHEIVRAIYMRSVAGIQNAFAIESMMDDLAAKAGMDPIAFRLKHTTNKRSRIVLETV
FT                   ARKAGWKPLQKPVIDGDLIESRGIGALCAGDGKLANHGAWGNLATIVDIVLNKRTGVIR
FT                   VKRVFVAFDAGRVANPDGLRNQAEGGTIMGISRALKEQVLFRGAAVASADWLTYPVLQF
FT                   SDVPESIDVTLIDSDHAPLGAGEVPNVTPACAIGNAVFAATGVRIRELPLTPDRVKAAL
FT                   TVA"
     MPRENLPSSP AGNVVSPGRR GFLKAGGALV VTFCIPVISS SATRADTFGK VPPEQLDSWI        60
     AVQQDGSVSA FTGRIDMGTG VETVFVQAVA EELDVPVSSV TFVMGDTART VDQGKSTASN       120
     NIARNLPPLR QAAAEARLAL MDLAAARLGV PSQKLVVKDG VVSVSGGGQS VSYGELVGGK       180
     RFDIRLGVKG DGNRTQLTGR AKLKDPKEFK VLGTSVPRVD IPAKVQGKFK YVHDVVVDGM       240
     AHGTVVLPPA RGMKLVSVNG FAQPVPGVVK VVTRGNFVGI VAETEQAAVR ARNALNVTWA       300
     PGTNENFDDM YGTIRKTPVI KDEIEGVVGN VRTAFANAAT VVEGTYYLPV NSHGMMGPSC       360
     AVADFREGSL TLWSGSQWPD GTRRDVAGML GMPIDKVRLI WVQGSGSYGR LGVDDAAGDA       420
     ALLSQAVGRP VRVQWQRADE NQWSPFCPAA VIHVKAGLDA QGKITAWEFE NWTPGHSTAE       480
     QGNILAWRAL GTNPGHKRLS GGADSPSYDI ANINVVTHYT HEIVRAIYMR SVAGIQNAFA       540
     IESMMDDLAA KAGMDPIAFR LKHTTNKRSR IVLETVARKA GWKPLQKPVI DGDLIESRGI       600
     GALCAGDGKL ANHGAWGNLA TIVDIVLNKR TGVIRVKRVF VAFDAGRVAN PDGLRNQAEG       660
     GTIMGISRAL KEQVLFRGAA VASADWLTYP VLQFSDVPES IDVTLIDSDH APLGAGEVPN       720
     VTPACAIGNA VFAATGVRIR ELPLTPDRVK AALTVA                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page