(data stored in ACNUC7421 zone)

EMBL: CP000271.PE521

CP000271.PE521       Location/Qualifiers
FT   CDS             complement(622499..623917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2502"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2502"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33489"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR012831"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q13R00"
FT                   /protein_id="ABE33489.1"
FT                   /translation="MIDVLVIGGGNAALCAALTAREAGASVTLLEAAPREWRGGNSQHT
FT                   RNLRCMHDEPQDVLVDAYPEEEFWQDLLKVTGGITDEHLARLVIRHSSSCRDWMRRHGV
FT                   NFQPPLSGTLHLSRTNAFFMGGGKALVNAYYRSARQLGVEIRYETPVDSLELDDNGNFI
FT                   AAHTSSGRIEARSCVLACGGFESNREWLREAWGQNERGEWPGENFLIRGTRFNQGVLLK
FT                   FLMQHGADIIGDPSQGHCVAIDARAPLYDGGICTRIDCVSLGIVVNRDAVRFYDEGEDF
FT                   WPKRYAIWGRLTALQPGQIAYSIIDAKAIGRFMPPVFPGIQADTLPELARKIGLDEAQF
FT                   VQTVETYNAACRIGTFDHTVLDDCHTENLQPAKTHWARPIDTGPFYAFAVRPGITFTYL
FT                   GLKVDETAAVRFNGRPSENLFVAGEMMAGNVLGKGYTAGVGMSIGTAFGRIAGTQAAKA
FT                   ALQRHQTGALHEAA"
     MIDVLVIGGG NAALCAALTA REAGASVTLL EAAPREWRGG NSQHTRNLRC MHDEPQDVLV        60
     DAYPEEEFWQ DLLKVTGGIT DEHLARLVIR HSSSCRDWMR RHGVNFQPPL SGTLHLSRTN       120
     AFFMGGGKAL VNAYYRSARQ LGVEIRYETP VDSLELDDNG NFIAAHTSSG RIEARSCVLA       180
     CGGFESNREW LREAWGQNER GEWPGENFLI RGTRFNQGVL LKFLMQHGAD IIGDPSQGHC       240
     VAIDARAPLY DGGICTRIDC VSLGIVVNRD AVRFYDEGED FWPKRYAIWG RLTALQPGQI       300
     AYSIIDAKAI GRFMPPVFPG IQADTLPELA RKIGLDEAQF VQTVETYNAA CRIGTFDHTV       360
     LDDCHTENLQ PAKTHWARPI DTGPFYAFAV RPGITFTYLG LKVDETAAVR FNGRPSENLF       420
     VAGEMMAGNV LGKGYTAGVG MSIGTAFGRI AGTQAAKAAL QRHQTGALHE AA               472
//

If you have problems or comments...

PBIL Back to PBIL home page