(data stored in ACNUC7421 zone)

EMBL: CP000271.PE528

CP000271.PE528       Location/Qualifiers
FT   CDS             631581..631931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2495"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2495"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33496"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ3"
FT                   /protein_id="ABE33496.1"
FT                   /translation="MNDIVRIDQNARRSRALIHNGLLYISGQVPDERKGGVADQTRQVL
FT                   AKIDDLLKEAGTSKDRLLSAQIWLKTMDDFAEMNAVWDAWVIPGKTPTRCCGKVELNDP
FT                   HCLVEIVAVAAC"
     MNDIVRIDQN ARRSRALIHN GLLYISGQVP DERKGGVADQ TRQVLAKIDD LLKEAGTSKD        60
     RLLSAQIWLK TMDDFAEMNA VWDAWVIPGK TPTRCCGKVE LNDPHCLVEI VAVAAC           116
//

If you have problems or comments...

PBIL Back to PBIL home page