(data stored in SCRATCH zone)

EMBL: CP000271.PE53

CP000271.PE53        Location/Qualifiers
FT   CDS             59158..59565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2974"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2974"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33021"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB8"
FT                   /protein_id="ABE33021.1"
FT                   /translation="MSLVLPKRAPCGQLAAGRPPSLADFSETRASLCWRAFPGCAKNRC
FT                   GEGSRLFQPRLRCSALRGLSLCRCATDRPQAHLSAPFKVASASVPKTLTFASPTPAGHW
FT                   AFAIFYADHVRVFQSRQRVFAGSVLSPRCVL"
     MSLVLPKRAP CGQLAAGRPP SLADFSETRA SLCWRAFPGC AKNRCGEGSR LFQPRLRCSA        60
     LRGLSLCRCA TDRPQAHLSA PFKVASASVP KTLTFASPTP AGHWAFAIFY ADHVRVFQSR       120
     QRVFAGSVLS PRCVL                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page