(data stored in ACNUC7421 zone)

EMBL: CP000271.PE530

CP000271.PE530       Location/Qualifiers
FT   CDS             633747..634112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2493"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33498"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QZ1"
FT                   /protein_id="ABE33498.1"
FT                   /translation="MMSWGCVIGCAADFSRLFQCPKHMKLVIIRHRLLPGAAETALARI
FT                   NVLSERMRTQPGYCFRHVGTEAGDESCITSVTAWATASDCAAWEAHLAASPLPKVERLY
FT                   SSVEHISVDADGTSPHG"
     MMSWGCVIGC AADFSRLFQC PKHMKLVIIR HRLLPGAAET ALARINVLSE RMRTQPGYCF        60
     RHVGTEAGDE SCITSVTAWA TASDCAAWEA HLAASPLPKV ERLYSSVEHI SVDADGTSPH       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page