(data stored in ACNUC7421 zone)

EMBL: CP000271.PE532

CP000271.PE532       Location/Qualifiers
FT   CDS             635621..635926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33500"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY9"
FT                   /protein_id="ABE33500.1"
FT                   /translation="MTPLTFDQFKTQLESMLRDIPYGTSADLTGFAIAFWDGGKVVYAF
FT                   LSADGCGVIEDEFELTDYEWQHWQDDLAAWINEPMFSVRPEINKRAWTAPAGSGGR"
     MTPLTFDQFK TQLESMLRDI PYGTSADLTG FAIAFWDGGK VVYAFLSADG CGVIEDEFEL        60
     TDYEWQHWQD DLAAWINEPM FSVRPEINKR AWTAPAGSGG R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page