(data stored in ACNUC7421 zone)

EMBL: CP000271.PE534

CP000271.PE534       Location/Qualifiers
FT   CDS             complement(637614..638606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2489"
FT                   /product="Anti-Sigma regulatory factor (Ser/Thr protein
FT                   kinase and phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2489"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33502"
FT                   /db_xref="GOA:Q13QY7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY7"
FT                   /protein_id="ABE33502.1"
FT                   /translation="METTLSLADKSGVAHARRRAVEMAQALGLPDRSQADAALVVTEAA
FT                   TNILKYAGHGEIVLKSTDDAGASSLDVIALDRGPGIANLGAACSDGFSTGGSLGAGLGT
FT                   IARHSAVFDIYSIQGCGTALFARVGEKAAAEHPRFLVGAKSTPKRGQDINGDAWSVRHA
FT                   GGNLWLTLLDGLGHGPLAAEASRRAVDVFMRADPAALPQEVLRDVHSGIKATRGAVMAI
FT                   ARFDPVNAILSFAGVGNIVGIVNAGETTQHLLSTDGTVGYNMRSVRPTEARWAPGSVFI
FT                   ATTDGLTTRWNLNRHPGLISRHPSLIASVLHRDFARDSDDATIVVVKAL"
     METTLSLADK SGVAHARRRA VEMAQALGLP DRSQADAALV VTEAATNILK YAGHGEIVLK        60
     STDDAGASSL DVIALDRGPG IANLGAACSD GFSTGGSLGA GLGTIARHSA VFDIYSIQGC       120
     GTALFARVGE KAAAEHPRFL VGAKSTPKRG QDINGDAWSV RHAGGNLWLT LLDGLGHGPL       180
     AAEASRRAVD VFMRADPAAL PQEVLRDVHS GIKATRGAVM AIARFDPVNA ILSFAGVGNI       240
     VGIVNAGETT QHLLSTDGTV GYNMRSVRPT EARWAPGSVF IATTDGLTTR WNLNRHPGLI       300
     SRHPSLIASV LHRDFARDSD DATIVVVKAL                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page