(data stored in ACNUC7421 zone)

EMBL: CP000271.PE535

CP000271.PE535       Location/Qualifiers
FT   CDS             complement(638591..638980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2488"
FT                   /product="Putative Anti-Sigma regulatory factor (Ser/Thr
FT                   protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2488"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33503"
FT                   /db_xref="GOA:Q13QY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY6"
FT                   /protein_id="ABE33503.1"
FT                   /translation="MLEIRSADQVNLARKTVQDWATRLAFGTLDRTKFVTAASELARNT
FT                   LVHGRGGTLTISEIERDGRTGIKLVFEDTGPGIPDIEKALQDGFSTARSMGLGLGGARR
FT                   LVNEFEISSTVDVGTKVSIIQWKRR"
     MLEIRSADQV NLARKTVQDW ATRLAFGTLD RTKFVTAASE LARNTLVHGR GGTLTISEIE        60
     RDGRTGIKLV FEDTGPGIPD IEKALQDGFS TARSMGLGLG GARRLVNEFE ISSTVDVGTK       120
     VSIIQWKRR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page