(data stored in ACNUC7421 zone)

EMBL: CP000271.PE536

CP000271.PE536       Location/Qualifiers
FT   CDS             complement(639001..639372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2487"
FT                   /product="Anti-Sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2487"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33504"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY5"
FT                   /protein_id="ABE33504.1"
FT                   /translation="MEQIPVLKLGEFLLVSIQVELHDELVLSLQDDLTSRIERTRAKGV
FT                   LIDISALEIVDSFIGRTLGHIAAMARVMDAATVLVGMRPAVAITLVELGMSLHGIRTAL
FT                   DVDKGMALLRKSLEEGGES"
     MEQIPVLKLG EFLLVSIQVE LHDELVLSLQ DDLTSRIERT RAKGVLIDIS ALEIVDSFIG        60
     RTLGHIAAMA RVMDAATVLV GMRPAVAITL VELGMSLHGI RTALDVDKGM ALLRKSLEEG       120
     GES                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page