(data stored in ACNUC7421 zone)

EMBL: CP000271.PE537

CP000271.PE537       Location/Qualifiers
FT   CDS             complement(639374..640258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2486"
FT                   /product="Anti-Sigma-factor antagonist (STAS) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33505"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY4"
FT                   /protein_id="ABE33505.1"
FT                   /translation="MKEWTLSEQNELATILEKDGDTVLNAWVAGQLSGGIRQGVISEAE
FT                   LRESARSFLAVFARAVKTNYNAQLAGETWDSVRTHLVSLSRERVIQGFSPVETAMFVFS
FT                   LKEPLFEALRKSLGKNPEAFGDALWKLTQTLDSLGLITIEAYQASRQQIIERQQQELLD
FT                   LTTPVVRLWDSVVALPLIGTLDSERTQVVMESLLDSIVENEAAIAIIDITGVPTVDTLV
FT                   AQHLLKTVAAARLMGAECIISGIRPQIAQTIVHLGVDLGDVVTKATLAEALKIALRRVG
FT                   MTVTKIATAKQGD"
     MKEWTLSEQN ELATILEKDG DTVLNAWVAG QLSGGIRQGV ISEAELRESA RSFLAVFARA        60
     VKTNYNAQLA GETWDSVRTH LVSLSRERVI QGFSPVETAM FVFSLKEPLF EALRKSLGKN       120
     PEAFGDALWK LTQTLDSLGL ITIEAYQASR QQIIERQQQE LLDLTTPVVR LWDSVVALPL       180
     IGTLDSERTQ VVMESLLDSI VENEAAIAII DITGVPTVDT LVAQHLLKTV AAARLMGAEC       240
     IISGIRPQIA QTIVHLGVDL GDVVTKATLA EALKIALRRV GMTVTKIATA KQGD             294
//

If you have problems or comments...

PBIL Back to PBIL home page