(data stored in ACNUC7421 zone)

EMBL: CP000271.PE538

CP000271.PE538       Location/Qualifiers
FT   CDS             640460..640816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2485"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33506"
FT                   /db_xref="InterPro:IPR008894"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY3"
FT                   /protein_id="ABE33506.1"
FT                   /translation="MGIHCSAIAQGLPSAVASEDRISAAIDPWLTIAASEMPPVILLFR
FT                   PAFLEIGCAVTRIHLNRPWKGLHVPPLIWAAEVNFDPGSVALVLASDVYNEADYVRDYD
FT                   DYLALMKELTQKQV"
     MGIHCSAIAQ GLPSAVASED RISAAIDPWL TIAASEMPPV ILLFRPAFLE IGCAVTRIHL        60
     NRPWKGLHVP PLIWAAEVNF DPGSVALVLA SDVYNEADYV RDYDDYLALM KELTQKQV         118
//

If you have problems or comments...

PBIL Back to PBIL home page