(data stored in ACNUC7421 zone)

EMBL: CP000271.PE539

CP000271.PE539       Location/Qualifiers
FT   CDS             640821..642395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2484"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33507"
FT                   /db_xref="GOA:Q13QY2"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY2"
FT                   /protein_id="ABE33507.1"
FT                   /translation="MDRVVRLTSEPKSETHRQRVGMVAAALFVVLVIVVLRLAVIGGYP
FT                   STDEGIYEYYALIIHDRLSQDLRLPNDGMLMLYPLLTSFVYSLKVNPIFALRLIDVVPD
FT                   ALAAVLMLRISVRLSGSLIASALITALFFLLLNHPTFIQYGFKNSFFIALCPLLYAVIL
FT                   FLSGQQAGPGRFFAMGVLVALGVLLRETLLLFAVLGAVSIFVERGTRALKYFVAGGLAT
FT                   GSLVLIVAIGLRGPGGVSSLISGYVDTGVGYGAFGDLRWKLFKSSGQLAAQAAVAGLVM
FT                   SLAATVCIVVASIRGRTKEYFKPFVFWAAAALIPLVEPLSKLGLPYHFSWSLIGLCSIT
FT                   SLGWRACRFSGRVQKLIGSGVCIGVSLLLVWSQLQFQRGLFWGLTYPAFKETHGKYWAE
FT                   ESIQRSNYLLMADQIKRIAPANATLSSSAAMLILYPLTGLRPPCYGVSNLTVTAVTLHF
FT                   NVEAMRRAIESCPADVVVVTRRDLPGSSTVVQAIRELPQYRRVGTVDVSTARDYGTSSA
FT                   ELFVLQR"
     MDRVVRLTSE PKSETHRQRV GMVAAALFVV LVIVVLRLAV IGGYPSTDEG IYEYYALIIH        60
     DRLSQDLRLP NDGMLMLYPL LTSFVYSLKV NPIFALRLID VVPDALAAVL MLRISVRLSG       120
     SLIASALITA LFFLLLNHPT FIQYGFKNSF FIALCPLLYA VILFLSGQQA GPGRFFAMGV       180
     LVALGVLLRE TLLLFAVLGA VSIFVERGTR ALKYFVAGGL ATGSLVLIVA IGLRGPGGVS       240
     SLISGYVDTG VGYGAFGDLR WKLFKSSGQL AAQAAVAGLV MSLAATVCIV VASIRGRTKE       300
     YFKPFVFWAA AALIPLVEPL SKLGLPYHFS WSLIGLCSIT SLGWRACRFS GRVQKLIGSG       360
     VCIGVSLLLV WSQLQFQRGL FWGLTYPAFK ETHGKYWAEE SIQRSNYLLM ADQIKRIAPA       420
     NATLSSSAAM LILYPLTGLR PPCYGVSNLT VTAVTLHFNV EAMRRAIESC PADVVVVTRR       480
     DLPGSSTVVQ AIRELPQYRR VGTVDVSTAR DYGTSSAELF VLQR                        524
//

If you have problems or comments...

PBIL Back to PBIL home page