(data stored in ACNUC7421 zone)

EMBL: CP000271.PE54

CP000271.PE54        Location/Qualifiers
FT   CDS             59712..59990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2973"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2973"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33022"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB7"
FT                   /protein_id="ABE33022.1"
FT                   /translation="MRHVTIFVHDASLAWPIATSCRTVTTRFVHSVRVKRPVGQASSPL
FT                   LTYQINPSEISERGDLSHVILMLDNLTSHCLLPERHVRSLEQEASYS"
     MRHVTIFVHD ASLAWPIATS CRTVTTRFVH SVRVKRPVGQ ASSPLLTYQI NPSEISERGD        60
     LSHVILMLDN LTSHCLLPER HVRSLEQEAS YS                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page