(data stored in ACNUC7421 zone)

EMBL: CP000271.PE540

CP000271.PE540       Location/Qualifiers
FT   CDS             642948..644918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2483"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33508"
FT                   /db_xref="InterPro:IPR021884"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QY1"
FT                   /protein_id="ABE33508.1"
FT                   /translation="MNHIPRFAKRLSWLSAVFLIVLAAGCGGSSDNVSNGGDQPASAPG
FT                   GTQDTTRPAVSAAVPAPGATGVGVTTKIAVTFSKDMNPATISASSFTVSGPGATPIAGT
FT                   VNYTVGSRAAVFTSTNASLPAGTVLTATITTAAKDVSGNALQNNFVWTFTTAAAPDVTP
FT                   PTVSLSVPAAGATNAALNTHIAATFSEDMDPSTITATSFTLTGPGGAPVAGTVSYAAGA
FT                   KSAIFTPTSPAVLSAATAYTATITTAAKDLSGNALVSKFAWTFTTGTTTDTTPPSIVSA
FT                   NPANGVTGVCTNKSVNVTFSEAMDPSTLTGATFTVAASSTPATLLSGTVAYDVPSKVAT
FT                   FTTTSPLAANTSYTATVTTGVKDLAGNALALASVTTFTTNSSLCTTAPALGGAQPFGSF
FT                   GGNASVTNAGLNSVIHGDLGVNAASTKITGLTDSSGTHFTTTTSNNGLVTGLVYTLTAP
FT                   ANSVPGLAVTQASLDATTAFNSLSPASLPGGINVASLAQCPSCGGAGGGADELAGRTLP
FT                   PGVYLSSTGTFDIGGVGRTTANLTLDAGGDANAVWVFQTAAGTGTLNVGLTGPATPAVP
FT                   IQVLLVNGAQAKNVFWYVPAGAVIGTGSTMTGTMLANASITLSTVGGTPPTAVITTLNG
FT                   RAIALTAAVTMVNTVINLPSQ"
     MNHIPRFAKR LSWLSAVFLI VLAAGCGGSS DNVSNGGDQP ASAPGGTQDT TRPAVSAAVP        60
     APGATGVGVT TKIAVTFSKD MNPATISASS FTVSGPGATP IAGTVNYTVG SRAAVFTSTN       120
     ASLPAGTVLT ATITTAAKDV SGNALQNNFV WTFTTAAAPD VTPPTVSLSV PAAGATNAAL       180
     NTHIAATFSE DMDPSTITAT SFTLTGPGGA PVAGTVSYAA GAKSAIFTPT SPAVLSAATA       240
     YTATITTAAK DLSGNALVSK FAWTFTTGTT TDTTPPSIVS ANPANGVTGV CTNKSVNVTF       300
     SEAMDPSTLT GATFTVAASS TPATLLSGTV AYDVPSKVAT FTTTSPLAAN TSYTATVTTG       360
     VKDLAGNALA LASVTTFTTN SSLCTTAPAL GGAQPFGSFG GNASVTNAGL NSVIHGDLGV       420
     NAASTKITGL TDSSGTHFTT TTSNNGLVTG LVYTLTAPAN SVPGLAVTQA SLDATTAFNS       480
     LSPASLPGGI NVASLAQCPS CGGAGGGADE LAGRTLPPGV YLSSTGTFDI GGVGRTTANL       540
     TLDAGGDANA VWVFQTAAGT GTLNVGLTGP ATPAVPIQVL LVNGAQAKNV FWYVPAGAVI       600
     GTGSTMTGTM LANASITLST VGGTPPTAVI TTLNGRAIAL TAAVTMVNTV INLPSQ           656
//

If you have problems or comments...

PBIL Back to PBIL home page