(data stored in ACNUC7421 zone)

EMBL: CP000271.PE543

CP000271.PE543       Location/Qualifiers
FT   CDS             647706..648239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33511"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX8"
FT                   /protein_id="ABE33511.1"
FT                   /translation="MQATKENQTDTRTGTTDALAFLEADHRAVEKLFTAFKKADDDLEA
FT                   KAALAQRACEELTIHAMLEEELLYPAAQEALPDSDKVDVEEAYVEHYLVKSLIAKFETL
FT                   KAGDKGFDATFKVMSEMVDHHVEEEEQELFPELRKSKCDLRTLGEKLAKRKAELQAKLD
FT                   AVGSRAVGDKTATL"
     MQATKENQTD TRTGTTDALA FLEADHRAVE KLFTAFKKAD DDLEAKAALA QRACEELTIH        60
     AMLEEELLYP AAQEALPDSD KVDVEEAYVE HYLVKSLIAK FETLKAGDKG FDATFKVMSE       120
     MVDHHVEEEE QELFPELRKS KCDLRTLGEK LAKRKAELQA KLDAVGSRAV GDKTATL          177
//

If you have problems or comments...

PBIL Back to PBIL home page