(data stored in ACNUC7421 zone)

EMBL: CP000271.PE546

CP000271.PE546       Location/Qualifiers
FT   CDS             complement(650005..650427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2477"
FT                   /product="outer membrane transport energization protein
FT                   ExbD"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2477"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33514"
FT                   /db_xref="GOA:Q13QX5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX5"
FT                   /protein_id="ABE33514.1"
FT                   /translation="MAMTPFSDDEDSGLMNEINMTPLVDVMLVLLIIFLVTIPAMQHAV
FT                   KIDLPQASSQPDNVKPAHLDVAVRADGSILWDGHPVADDVLRARIAEAARAKPQPELHL
FT                   RADRKVPYERVADVMSAAQAGGLTKIGFVTDPRAKK"
     MAMTPFSDDE DSGLMNEINM TPLVDVMLVL LIIFLVTIPA MQHAVKIDLP QASSQPDNVK        60
     PAHLDVAVRA DGSILWDGHP VADDVLRARI AEAARAKPQP ELHLRADRKV PYERVADVMS       120
     AAQAGGLTKI GFVTDPRAKK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page