(data stored in ACNUC7421 zone)

EMBL: CP000271.PE547

CP000271.PE547       Location/Qualifiers
FT   CDS             complement(650418..651206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2476"
FT                   /product="outer membrane transport energization protein
FT                   ExbB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2476"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33515"
FT                   /db_xref="GOA:Q13QX4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX4"
FT                   /protein_id="ABE33515.1"
FT                   /translation="MQHYGLANVWESGDIVTRCILGTLLIMSVLSWTVILVKLWTIVRI
FT                   RRVTRQAEAQFWRADRFEDGLKSLGAEASKSVRDNPLLALALAGEEAAAHHRQTQSHLH
FT                   DRIDVSDWITRRLQDTMDDAIARMQSGLAVLASIGSTAPFVGLFGTVWGIYHALILIGE
FT                   TGQTSIDHVAGPVGESLIMTAFGLFVAIPAVLGYNGLTRANKSVVTRLKRFAHGLHAYF
FT                   VTGSQLPSSTGPDMRIVPRAVPAANGKANDATNDGALKWQ"
     MQHYGLANVW ESGDIVTRCI LGTLLIMSVL SWTVILVKLW TIVRIRRVTR QAEAQFWRAD        60
     RFEDGLKSLG AEASKSVRDN PLLALALAGE EAAAHHRQTQ SHLHDRIDVS DWITRRLQDT       120
     MDDAIARMQS GLAVLASIGS TAPFVGLFGT VWGIYHALIL IGETGQTSID HVAGPVGESL       180
     IMTAFGLFVA IPAVLGYNGL TRANKSVVTR LKRFAHGLHA YFVTGSQLPS STGPDMRIVP       240
     RAVPAANGKA NDATNDGALK WQ                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page