(data stored in ACNUC7421 zone)

EMBL: CP000271.PE548

CP000271.PE548       Location/Qualifiers
FT   CDS             complement(651234..651926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2475"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2475"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33516"
FT                   /db_xref="GOA:Q13QX3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX3"
FT                   /protein_id="ABE33516.1"
FT                   /translation="MALGAVVAAHVGLLAWVSATLDRTVERTVEAPAIVAMLLRNEPET
FT                   AAPITPVARAVPAPAAVVAAPQAAQPPARSKLAPPRLKAPRSSVAPAPGAPGAPDVPAT
FT                   PSPSRDAARSPEPTAPAVAAAPSPAAPATNAPATPKSVAHVDCDIPKPDYPDISKRRSE
FT                   SGTAIVRFVVGLSGHIETAQLQKSSGYPRLDDAALSAVHAGACQPYRENGEAVRAAYSE
FT                   SFVFGLTE"
     MALGAVVAAH VGLLAWVSAT LDRTVERTVE APAIVAMLLR NEPETAAPIT PVARAVPAPA        60
     AVVAAPQAAQ PPARSKLAPP RLKAPRSSVA PAPGAPGAPD VPATPSPSRD AARSPEPTAP       120
     AVAAAPSPAA PATNAPATPK SVAHVDCDIP KPDYPDISKR RSESGTAIVR FVVGLSGHIE       180
     TAQLQKSSGY PRLDDAALSA VHAGACQPYR ENGEAVRAAY SESFVFGLTE                  230
//

If you have problems or comments...

PBIL Back to PBIL home page