(data stored in ACNUC7421 zone)

EMBL: CP000271.PE549

CP000271.PE549       Location/Qualifiers
FT   CDS             652196..653290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2474"
FT                   /product="WD-40 repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2474"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33517"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX2"
FT                   /protein_id="ABE33517.1"
FT                   /translation="MLETRFRNTTPTRSLAFAVATLATAATAFALAASTAYAAAPMAYV
FT                   TSEKAGVGVIDLDQMTLTKTFPVGADGPRGLSLNTDGTRLLVANKNTGDLAVIDTASGQ
FT                   VVQRVKIGKNPEYVRVHNGFAYVTYEPGEDGGPPAANAKPGADDDDANKPPAQIAIVDM
FT                   KTWRVIRSVTSGHETEGIEFSRDGNMMLVTNEGDDTVSVYHVRTGAPVRTVKLVAGGRP
FT                   RGIRLSPDGKDYVVTLESLSKFVVIDARTYQVTKTVDTKLGPYGVAFGPDGKRLFVAAA
FT                   RDRTVQVFDGHSYEHLADVPVGQRCWHFSFTPDGAKLLVACGRSDAVYVLDAQSYQPIK
FT                   QIGELPLAWGIVTYPHSDGSIESH"
     MLETRFRNTT PTRSLAFAVA TLATAATAFA LAASTAYAAA PMAYVTSEKA GVGVIDLDQM        60
     TLTKTFPVGA DGPRGLSLNT DGTRLLVANK NTGDLAVIDT ASGQVVQRVK IGKNPEYVRV       120
     HNGFAYVTYE PGEDGGPPAA NAKPGADDDD ANKPPAQIAI VDMKTWRVIR SVTSGHETEG       180
     IEFSRDGNMM LVTNEGDDTV SVYHVRTGAP VRTVKLVAGG RPRGIRLSPD GKDYVVTLES       240
     LSKFVVIDAR TYQVTKTVDT KLGPYGVAFG PDGKRLFVAA ARDRTVQVFD GHSYEHLADV       300
     PVGQRCWHFS FTPDGAKLLV ACGRSDAVYV LDAQSYQPIK QIGELPLAWG IVTYPHSDGS       360
     IESH                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page