(data stored in SCRATCH zone)

EMBL: CP000271.PE55

CP000271.PE55        Location/Qualifiers
FT   CDS             60092..60652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2972"
FT                   /product="putative fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2972"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33023"
FT                   /db_xref="GOA:Q13SB6"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB6"
FT                   /protein_id="ABE33023.1"
FT                   /translation="MKLSLPAIAIAASSLFGLVPLGAHAADGTISITGTVTDSTCSING
FT                   NANGTPADKAITLATVPAGSLASAGAVAGTSNPTDLQLSLTGCTGTATKAIARFENGPT
FT                   VDQTNGYLSNTAGTAQNVEVRLLNAQMQPINVTTGANNDITTNAATISGGAATLQYFAQ
FT                   YYATGVATAGTVSSSVQYSMEYQ"
     MKLSLPAIAI AASSLFGLVP LGAHAADGTI SITGTVTDST CSINGNANGT PADKAITLAT        60
     VPAGSLASAG AVAGTSNPTD LQLSLTGCTG TATKAIARFE NGPTVDQTNG YLSNTAGTAQ       120
     NVEVRLLNAQ MQPINVTTGA NNDITTNAAT ISGGAATLQY FAQYYATGVA TAGTVSSSVQ       180
     YSMEYQ                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page