(data stored in ACNUC7421 zone)

EMBL: CP000271.PE550

CP000271.PE550       Location/Qualifiers
FT   CDS             complement(653377..655743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2473"
FT                   /product="Putative TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2473"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33518"
FT                   /db_xref="GOA:Q13QX1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX1"
FT                   /protein_id="ABE33518.1"
FT                   /translation="MNMPLSAHRASRLPDLPRLRRRAGLTLCFGSALASLSVPVWAQAE
FT                   TATPAAAASSAAPAGASPDADTVKLAPIVVVGTTPLLGIGTPLSQVPANVQTVHAQDLE
FT                   QQHRSTLTDYFAKNLPSVDIADAQGNPYQVNLNYRGFTASPLLGTPQGLSVFVDGVRVN
FT                   EPFGDVVNWDLLPQQAIDTIQLIPGSNPTYGLNTLGGALAITTKNGKTSPGGEAEVQVG
FT                   SWGRKTAQIEQGGTIGQNLDYYVTGSMANDNGWAEQNASRVRQAFGKLRYTDADTTLSF
FT                   SAGGADNDLHGTQTIPRSFLGNPKQPYTYPDQNLNTAAYATLSGDHYFNDHVELSGNVY
FT                   YRHFRNDNVSSNTNSDFGSVDDDGNVDTTQATNEKSIVSTDSYGASLQLTLLGKLGGME
FT                   NQFVAGVSADIANSRYTQSSQDAVFTASRATIGIGDFEQETAAKTHNGNYGIYLQDTLS
FT                   LTKQWTLTLAGRYNWADATIGDSSGTQPQLDGHHTFSRFNPAVGINWNPTSAFTAYATY
FT                   NEGMRSPTAIELACADPSAPCSLPNDFVSDPSLQPVISKTFEIGARGRIGQATTWSAAA
FT                   YSTTLDNDIEFISTNGATSNQGFFQNVGRTRRQGVELSGHSQFGPLAVTASYSYVDATY
FT                   RSSWTESSPSNSSADQNGNITVKPGDHIPSIPANTVKLQLDYAATAKWNVGTNLTWRGS
FT                   VYAQGDENNQDVNGKIAGYLLIDLDTSYQVTKQLQVFASVTNLLDKRYASFGALGENFF
FT                   NGANHTFDGANPINEQFVGPGAPRGFWVGLRYAWK"
     MNMPLSAHRA SRLPDLPRLR RRAGLTLCFG SALASLSVPV WAQAETATPA AAASSAAPAG        60
     ASPDADTVKL APIVVVGTTP LLGIGTPLSQ VPANVQTVHA QDLEQQHRST LTDYFAKNLP       120
     SVDIADAQGN PYQVNLNYRG FTASPLLGTP QGLSVFVDGV RVNEPFGDVV NWDLLPQQAI       180
     DTIQLIPGSN PTYGLNTLGG ALAITTKNGK TSPGGEAEVQ VGSWGRKTAQ IEQGGTIGQN       240
     LDYYVTGSMA NDNGWAEQNA SRVRQAFGKL RYTDADTTLS FSAGGADNDL HGTQTIPRSF       300
     LGNPKQPYTY PDQNLNTAAY ATLSGDHYFN DHVELSGNVY YRHFRNDNVS SNTNSDFGSV       360
     DDDGNVDTTQ ATNEKSIVST DSYGASLQLT LLGKLGGMEN QFVAGVSADI ANSRYTQSSQ       420
     DAVFTASRAT IGIGDFEQET AAKTHNGNYG IYLQDTLSLT KQWTLTLAGR YNWADATIGD       480
     SSGTQPQLDG HHTFSRFNPA VGINWNPTSA FTAYATYNEG MRSPTAIELA CADPSAPCSL       540
     PNDFVSDPSL QPVISKTFEI GARGRIGQAT TWSAAAYSTT LDNDIEFIST NGATSNQGFF       600
     QNVGRTRRQG VELSGHSQFG PLAVTASYSY VDATYRSSWT ESSPSNSSAD QNGNITVKPG       660
     DHIPSIPANT VKLQLDYAAT AKWNVGTNLT WRGSVYAQGD ENNQDVNGKI AGYLLIDLDT       720
     SYQVTKQLQV FASVTNLLDK RYASFGALGE NFFNGANHTF DGANPINEQF VGPGAPRGFW       780
     VGLRYAWK                                                                788
//

If you have problems or comments...

PBIL Back to PBIL home page