(data stored in ACNUC7421 zone)

EMBL: CP000271.PE551

CP000271.PE551       Location/Qualifiers
FT   CDS             655948..656958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2472"
FT                   /product="Periplasmic Sensor signal transduction Histidine
FT                   Kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33519"
FT                   /db_xref="GOA:Q13QX0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QX0"
FT                   /protein_id="ABE33519.1"
FT                   /translation="MASDPSNPSSARPVPPHSTVRRDLAWVLALTVLAAVLSARFDFSE
FT                   HAYRWTRGLERFQLDELPGTLCVLSIGLAWFAWRRYREARRELIRRCALEEQAERLLAE
FT                   NRRLANQALQAQELERRHLARELHDELGQYLNAISLDAARIRDLSSAREPEVHRVSLGL
FT                   IQSASHVYRQIGGMIRRLRPIGLDEFGLPSALEHCVDGWRERLPDASFSLTIEGDFTGL
FT                   SDALTITLYRLVQEGLTNVSKFARTARVEVFMVRAPREARERQDGRLVDEIVVTMADDG
FT                   PGADLDKPRGGLGLIGMRERVEALGGEFHVASRPEGGFLFCARVPAHAGLAEPVN"
     MASDPSNPSS ARPVPPHSTV RRDLAWVLAL TVLAAVLSAR FDFSEHAYRW TRGLERFQLD        60
     ELPGTLCVLS IGLAWFAWRR YREARRELIR RCALEEQAER LLAENRRLAN QALQAQELER       120
     RHLARELHDE LGQYLNAISL DAARIRDLSS AREPEVHRVS LGLIQSASHV YRQIGGMIRR       180
     LRPIGLDEFG LPSALEHCVD GWRERLPDAS FSLTIEGDFT GLSDALTITL YRLVQEGLTN       240
     VSKFARTARV EVFMVRAPRE ARERQDGRLV DEIVVTMADD GPGADLDKPR GGLGLIGMRE       300
     RVEALGGEFH VASRPEGGFL FCARVPAHAG LAEPVN                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page