(data stored in ACNUC7421 zone)

EMBL: CP000271.PE56

CP000271.PE56        Location/Qualifiers
FT   CDS             60728..61471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2971"
FT                   /product="Putative fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2971"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33024"
FT                   /db_xref="GOA:Q13SB5"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB5"
FT                   /protein_id="ABE33024.1"
FT                   /translation="MKLLKKMPIGIGFACALLAGSAQASVTIGGTRVVYPLEQREVTVK
FT                   LDNDSKTPSLVQAWIDDGNADAKPGEIKVPFVITPPIFRMDAKKGQTLRVMYTGEPLPQ
FT                   DRESVYWLNVLDIPPKASSATEVNSLSLAYRTRIKVFARPAGLPGKPEDAAAQLSWKIA
FT                   ASADGKSHALSVSNPTPYYVSFSEIDVESNGHTFRNEQGGMVAPRASAVLPIAKMNAVA
FT                   AGAKVHYIAISDYGGPIDGDAALGE"
     MKLLKKMPIG IGFACALLAG SAQASVTIGG TRVVYPLEQR EVTVKLDNDS KTPSLVQAWI        60
     DDGNADAKPG EIKVPFVITP PIFRMDAKKG QTLRVMYTGE PLPQDRESVY WLNVLDIPPK       120
     ASSATEVNSL SLAYRTRIKV FARPAGLPGK PEDAAAQLSW KIAASADGKS HALSVSNPTP       180
     YYVSFSEIDV ESNGHTFRNE QGGMVAPRAS AVLPIAKMNA VAAGAKVHYI AISDYGGPID       240
     GDAALGE                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page