(data stored in ACNUC7421 zone)

EMBL: CP000271.PE564

CP000271.PE564       Location/Qualifiers
FT   CDS             668507..669562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2459"
FT                   /product="Conserved hypothetical protein (orf1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33532"
FT                   /db_xref="GOA:Q13QV7"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR024710"
FT                   /db_xref="InterPro:IPR040803"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV7"
FT                   /protein_id="ABE33532.1"
FT                   /translation="MTKIFVYEYLTGGGIDPAHAGAASLADLSALIVEGRVMRDALVSE
FT                   LRELDGVDVSFASSRFETVDPALAHCRAAQGESMTAFVARVAREHDYAWVIAPECDGLL
FT                   LQLYDAVGAARWLGCAKEAIRVASSKSATAALLAAQGVATTPAIEPGQSDVQRGERWVV
FT                   KPDDGAGGLDTFVFDSFADACAEYDARAAAARNPVLQAWVDGEPLSLSLICRADGVELI
FT                   SINRQQISLSANDTSQRQPRIVEFDGVTVNQIDLAGDQGRLLGALAQRVAKAMPGLRGF
FT                   VGIDVVWHPQRGPVVIEVNPRLTVAYAGLSAGARGGDLARTLLAAHGVRVGRSGPAARS
FT                   RGAQSACGARP"
     MTKIFVYEYL TGGGIDPAHA GAASLADLSA LIVEGRVMRD ALVSELRELD GVDVSFASSR        60
     FETVDPALAH CRAAQGESMT AFVARVAREH DYAWVIAPEC DGLLLQLYDA VGAARWLGCA       120
     KEAIRVASSK SATAALLAAQ GVATTPAIEP GQSDVQRGER WVVKPDDGAG GLDTFVFDSF       180
     ADACAEYDAR AAAARNPVLQ AWVDGEPLSL SLICRADGVE LISINRQQIS LSANDTSQRQ       240
     PRIVEFDGVT VNQIDLAGDQ GRLLGALAQR VAKAMPGLRG FVGIDVVWHP QRGPVVIEVN       300
     PRLTVAYAGL SAGARGGDLA RTLLAAHGVR VGRSGPAARS RGAQSACGAR P                351
//

If you have problems or comments...

PBIL Back to PBIL home page