(data stored in ACNUC7421 zone)

EMBL: CP000271.PE569

CP000271.PE569       Location/Qualifiers
FT   CDS             673033..673431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2454"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2454"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33537"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV2"
FT                   /protein_id="ABE33537.1"
FT                   /translation="MFPPGIDTALRRRPGVMPDFIGVGYYASSMPDVRRHGVGSAPARR
FT                   NTAFAELRRRGHRARGTMRLHRALFRECSKVFHDGQRLPLLSRNACNSYANHSLPIASA
FT                   CVENFASWPAFSRSAFSVIDNGSVKSAK"
     MFPPGIDTAL RRRPGVMPDF IGVGYYASSM PDVRRHGVGS APARRNTAFA ELRRRGHRAR        60
     GTMRLHRALF RECSKVFHDG QRLPLLSRNA CNSYANHSLP IASACVENFA SWPAFSRSAF       120
     SVIDNGSVKS AK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page