(data stored in ACNUC7421 zone)

EMBL: CP000271.PE57

CP000271.PE57        Location/Qualifiers
FT   CDS             61604..64246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2970"
FT                   /product="Putative fimbrial biogenesis outer membrane usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2970"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33025"
FT                   /db_xref="GOA:Q13SB4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB4"
FT                   /protein_id="ABE33025.1"
FT                   /translation="MKDFPCCRSLVRAGEPGGAFGLNPVAAVVALAFAVLGGVQPIVAQ
FT                   ASGQAEAGAAVEFDSTFLRVDPNATVDVSRFTRGNPMSEGVYSVDVLVNGVRVARHDVR
FT                   FVATSGTATARPCFSRQMLETLGVDFARVAASSDAKTPAETGVTGECVDLAATVPDAMV
FT                   DFDFAEQKIALSVPQKYMRNAARGYVPPDMWQTGVNAAFLSYNANAYHSAGSGVESTQS
FT                   YVGLNAGVNLGAWHFRHQSSVTQQAGAATQFDNIATYLQRDITRIKSQLTVGDGYTTGD
FT                   VFDSVQFRGAQIATDDRMLPESLRGYAPIVRGTAESNARVTVRQNGQVIYETTVSPGPF
FT                   EINDLYATGYGGNLDVTVTEANGRTKSFTVPYASVAQSLRPGTTRFSVTAGELRNSTLE
FT                   TNPNFAQFTLQRGLTNLVTVYGGAVAANGYMAADMGAALNTKFGALSADVTGAQTQIPD
FT                   HGTLRGTSLRIGYSKFIDPTNTNIAIAAYRYSTAGYMNLSDAASVRDLAMHGGNPDSVY
FT                   RQRNRFQVTLNQNFKEYGTVFLNASAQQYWNRSGSDVFYQAGYTNRFKYGTYSISAGRT
FT                   RNSNGSMSDQIMLSTTLPLGRDQHSPLLSANLSSSGGNANLQANVSGSLGERNQFSYSG
FT                   YGAYGDGPGASTASAGASGTYRTPYAQLTGSASGGTGSSQVSAGISGSIVAHPGGVTFS
FT                   QTVGDTFGVIEAPGAAGASVTSSPGVKLNGRGFAVVPYLTPYGINTVDIDPKGTSTDVE
FT                   FESTSEQAVPRLGSVVMIRYKTVTGRAALIRAPQLGDKALPFGADVVDATGRTVGVVAQ
FT                   DSRIFARGLEDKGSLFVKWGASASEQCRIEYVLPRQTGKAGAAYTSVEGHCVGGTPTEN
FT                   TNFASGRTR"
     MKDFPCCRSL VRAGEPGGAF GLNPVAAVVA LAFAVLGGVQ PIVAQASGQA EAGAAVEFDS        60
     TFLRVDPNAT VDVSRFTRGN PMSEGVYSVD VLVNGVRVAR HDVRFVATSG TATARPCFSR       120
     QMLETLGVDF ARVAASSDAK TPAETGVTGE CVDLAATVPD AMVDFDFAEQ KIALSVPQKY       180
     MRNAARGYVP PDMWQTGVNA AFLSYNANAY HSAGSGVEST QSYVGLNAGV NLGAWHFRHQ       240
     SSVTQQAGAA TQFDNIATYL QRDITRIKSQ LTVGDGYTTG DVFDSVQFRG AQIATDDRML       300
     PESLRGYAPI VRGTAESNAR VTVRQNGQVI YETTVSPGPF EINDLYATGY GGNLDVTVTE       360
     ANGRTKSFTV PYASVAQSLR PGTTRFSVTA GELRNSTLET NPNFAQFTLQ RGLTNLVTVY       420
     GGAVAANGYM AADMGAALNT KFGALSADVT GAQTQIPDHG TLRGTSLRIG YSKFIDPTNT       480
     NIAIAAYRYS TAGYMNLSDA ASVRDLAMHG GNPDSVYRQR NRFQVTLNQN FKEYGTVFLN       540
     ASAQQYWNRS GSDVFYQAGY TNRFKYGTYS ISAGRTRNSN GSMSDQIMLS TTLPLGRDQH       600
     SPLLSANLSS SGGNANLQAN VSGSLGERNQ FSYSGYGAYG DGPGASTASA GASGTYRTPY       660
     AQLTGSASGG TGSSQVSAGI SGSIVAHPGG VTFSQTVGDT FGVIEAPGAA GASVTSSPGV       720
     KLNGRGFAVV PYLTPYGINT VDIDPKGTST DVEFESTSEQ AVPRLGSVVM IRYKTVTGRA       780
     ALIRAPQLGD KALPFGADVV DATGRTVGVV AQDSRIFARG LEDKGSLFVK WGASASEQCR       840
     IEYVLPRQTG KAGAAYTSVE GHCVGGTPTE NTNFASGRTR                             880
//

If you have problems or comments...

PBIL Back to PBIL home page