(data stored in ACNUC7421 zone)

EMBL: CP000271.PE570

CP000271.PE570       Location/Qualifiers
FT   CDS             673526..675025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2453"
FT                   /product="ribulose-1,5-bisphosphate carboxylase/oxygenase
FT                   large subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2453"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33538"
FT                   /db_xref="GOA:Q13QV1"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR020888"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13QV1"
FT                   /protein_id="ABE33538.1"
FT                   /translation="MNDFSQPVIDSIHKPRDAANPRERYAAGVMKYREMGYWQPDYAPK
FT                   DTDVIALFRITPQPGVDPEEAAAAVAGESSTATWTVVWTDRLTACDIYRAKAYRVDPVP
FT                   ASNAAEPQYFAYIAYELDLFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKT
FT                   FQGPPTGIVVERERLDKYGRPLLGATVKPKLGLSGKNYGRVVYEGLRGGLDFLKDDENI
FT                   NSQAFMHWRDRFLFAMEAVNRAQAETGEVKGHYLNVTAGTMEDMYERAEFAKELGSCIV
FT                   MIDLVIGWTAIQSMARWARRNDMILHLHRAGHSTYTRQRNHGISFRVIAKWLRMAGVDH
FT                   AHAGTAVGKLEGDPLSVQGYYNVCRESHNEVDLSRGIFFDQPWAGLRKVMPVASGGIHA
FT                   GQMHQLLDLFGDDAILQFGGGTIGHPAGIQAGAVANRVALEAMVKARNEGRDIVHEGPD
FT                   ILEAAARWCTPLKQALDTWRDVTFNYASTDTPDFAATPTAA"
     MNDFSQPVID SIHKPRDAAN PRERYAAGVM KYREMGYWQP DYAPKDTDVI ALFRITPQPG        60
     VDPEEAAAAV AGESSTATWT VVWTDRLTAC DIYRAKAYRV DPVPASNAAE PQYFAYIAYE       120
     LDLFEEGSVA NLTASIIGNV FGFKPLKALR LEDMRIPVAY LKTFQGPPTG IVVERERLDK       180
     YGRPLLGATV KPKLGLSGKN YGRVVYEGLR GGLDFLKDDE NINSQAFMHW RDRFLFAMEA       240
     VNRAQAETGE VKGHYLNVTA GTMEDMYERA EFAKELGSCI VMIDLVIGWT AIQSMARWAR       300
     RNDMILHLHR AGHSTYTRQR NHGISFRVIA KWLRMAGVDH AHAGTAVGKL EGDPLSVQGY       360
     YNVCRESHNE VDLSRGIFFD QPWAGLRKVM PVASGGIHAG QMHQLLDLFG DDAILQFGGG       420
     TIGHPAGIQA GAVANRVALE AMVKARNEGR DIVHEGPDIL EAAARWCTPL KQALDTWRDV       480
     TFNYASTDTP DFAATPTAA                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page