(data stored in ACNUC7421 zone)

EMBL: CP000271.PE571

CP000271.PE571       Location/Qualifiers
FT   CDS             675134..675562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2452"
FT                   /product="ribulose 1,5-bisphosphate carboxylase small
FT                   subunit"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2452"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33539"
FT                   /db_xref="GOA:Q13QV0"
FT                   /db_xref="InterPro:IPR000894"
FT                   /db_xref="InterPro:IPR036385"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QV0"
FT                   /protein_id="ABE33539.1"
FT                   /translation="MRITQGTFSFLPELTDEEIRLQIDYALSQGWACSVEYTDDPHPRN
FT                   TYWEMWGLPMFDLRDAAGVLQEVKACRAAQPQHYIKVNAFDSVRGFETMRLSFIVNRPD
FT                   EEPGFRLTRQDGPGRVQRYGLSGYAGDRPSGERYGPAR"
     MRITQGTFSF LPELTDEEIR LQIDYALSQG WACSVEYTDD PHPRNTYWEM WGLPMFDLRD        60
     AAGVLQEVKA CRAAQPQHYI KVNAFDSVRG FETMRLSFIV NRPDEEPGFR LTRQDGPGRV       120
     QRYGLSGYAG DRPSGERYGP AR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page