(data stored in ACNUC7421 zone)

EMBL: CP000271.PE572

CP000271.PE572       Location/Qualifiers
FT   CDS             675618..676667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2451"
FT                   /product="CbbX-like protein, putative AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2451"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33540"
FT                   /db_xref="GOA:Q13QU9"
FT                   /db_xref="InterPro:IPR000470"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU9"
FT                   /protein_id="ABE33540.1"
FT                   /translation="MTEAAAIDANALCSDGRDAAALQDSQDSRAQAPQVDLAALYRDSG
FT                   IGDVLAELDRDLVGLAPVKTRIREIAAHLLVERARDSLGLAGGAPTLHMCFSGNPGTGK
FT                   TTVALRMAEVLHRLGYIRRNHLVSVTRDDLVGQYIGHTAPKTRDVLKRAMGGVLFIDEA
FT                   YYLYRPENERDYGQEAIEILLQTMENQRDDLVVILAGYAARMEVFFESNPGFRSRIAHH
FT                   ITFPDYDGAELLDIAERMLATMHYRFDADSRRAFADYLALRTRQANFANARSVRNALDR
FT                   SRLRQANRLFATAMQGGAPIDAAALTLIAAADVRASRVFTESEALAANAGAPASSHATA
FT                   TRAVTAPPG"
     MTEAAAIDAN ALCSDGRDAA ALQDSQDSRA QAPQVDLAAL YRDSGIGDVL AELDRDLVGL        60
     APVKTRIREI AAHLLVERAR DSLGLAGGAP TLHMCFSGNP GTGKTTVALR MAEVLHRLGY       120
     IRRNHLVSVT RDDLVGQYIG HTAPKTRDVL KRAMGGVLFI DEAYYLYRPE NERDYGQEAI       180
     EILLQTMENQ RDDLVVILAG YAARMEVFFE SNPGFRSRIA HHITFPDYDG AELLDIAERM       240
     LATMHYRFDA DSRRAFADYL ALRTRQANFA NARSVRNALD RSRLRQANRL FATAMQGGAP       300
     IDAAALTLIA AADVRASRVF TESEALAANA GAPASSHATA TRAVTAPPG                   349
//

If you have problems or comments...

PBIL Back to PBIL home page