(data stored in ACNUC7421 zone)

EMBL: CP000271.PE578

CP000271.PE578       Location/Qualifiers
FT   CDS             complement(682764..683690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2445"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2445"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33546"
FT                   /db_xref="GOA:Q13QU3"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU3"
FT                   /protein_id="ABE33546.1"
FT                   /translation="MLLYSVGVLFSVSGARYVVATIIHHGVHGHLTRKPIVNQALCEVL
FT                   STLLIVQPYESYRRFHVYEHHGRDFSTLNDKDLAAIYKLGFTPGKSKGALYRNLVITLL
FT                   NPAFHLTFFWGRLKSNLVSVRLYRLCMSVLWLISLAVFAAHFGTLFFVAIVVVPYVVVY
FT                   QAASLLHLLTEHVWLLRLPPESVRESHVRNSLGRFCGSACPAGWGIVHLVPWLKWSIAH
FT                   LFFHLPCRMLIVQGSLVCHDWHHRFGSTRQWHDYAALREADAVKLVAEGRYDYTEIWGF
FT                   DHCLDHVFERLSASDAVHVGNLNYRLN"
     MLLYSVGVLF SVSGARYVVA TIIHHGVHGH LTRKPIVNQA LCEVLSTLLI VQPYESYRRF        60
     HVYEHHGRDF STLNDKDLAA IYKLGFTPGK SKGALYRNLV ITLLNPAFHL TFFWGRLKSN       120
     LVSVRLYRLC MSVLWLISLA VFAAHFGTLF FVAIVVVPYV VVYQAASLLH LLTEHVWLLR       180
     LPPESVRESH VRNSLGRFCG SACPAGWGIV HLVPWLKWSI AHLFFHLPCR MLIVQGSLVC       240
     HDWHHRFGST RQWHDYAALR EADAVKLVAE GRYDYTEIWG FDHCLDHVFE RLSASDAVHV       300
     GNLNYRLN                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page