(data stored in ACNUC7421 zone)

EMBL: CP000271.PE579

CP000271.PE579       Location/Qualifiers
FT   CDS             complement(683951..684262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2444"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2444"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33547"
FT                   /db_xref="GOA:Q13QU2"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU2"
FT                   /protein_id="ABE33547.1"
FT                   /translation="MSWWLILTLAAVVFFNRYVFLEPKVPVKLPRLLSNALEYSAPCLL
FT                   TAICAPIILMDKGLLRSFPGNPYFLGAAFSVVFALVIRSVVLSVVMSLAVFYLLARFL"
     MSWWLILTLA AVVFFNRYVF LEPKVPVKLP RLLSNALEYS APCLLTAICA PIILMDKGLL        60
     RSFPGNPYFL GAAFSVVFAL VIRSVVLSVV MSLAVFYLLA RFL                         103
//

If you have problems or comments...

PBIL Back to PBIL home page