(data stored in SCRATCH zone)

EMBL: CP000271.PE58

CP000271.PE58        Location/Qualifiers
FT   CDS             64382..65398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2969"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2969"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33026"
FT                   /db_xref="GOA:Q13SB3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB3"
FT                   /protein_id="ABE33026.1"
FT                   /translation="MCLTLVLGSALFAARPAHAALICNASGANNVISAGSISVPANPTI
FT                   GATIATLAPTQFQMPCRFDTSAPVETSATLWATFDSSLPPVSGFADVYQTNVQGLGIRY
FT                   TFNAPACNANNVPMTSGEVKLTCPVSGPVDGPYMPIDVTVTPSFVATGVIPLGARTLST
FT                   VPLVSIVYWTSDDPATGWDKPPLYTGAASGRIIHACAINQPDASVTLPTVNSSAFSGGV
FT                   GSVAGPQSFSLVFSCGSGAQVSIVLTDNTDPSNRSNVLTPTPDSTAKGIGIQILNDSGA
FT                   PVSFGPDSSEPFTTNQWVIGRSPDGRLEVPLIARYIRTGNVVAGAIRALATFTMSYQ"
     MCLTLVLGSA LFAARPAHAA LICNASGANN VISAGSISVP ANPTIGATIA TLAPTQFQMP        60
     CRFDTSAPVE TSATLWATFD SSLPPVSGFA DVYQTNVQGL GIRYTFNAPA CNANNVPMTS       120
     GEVKLTCPVS GPVDGPYMPI DVTVTPSFVA TGVIPLGART LSTVPLVSIV YWTSDDPATG       180
     WDKPPLYTGA ASGRIIHACA INQPDASVTL PTVNSSAFSG GVGSVAGPQS FSLVFSCGSG       240
     AQVSIVLTDN TDPSNRSNVL TPTPDSTAKG IGIQILNDSG APVSFGPDSS EPFTTNQWVI       300
     GRSPDGRLEV PLIARYIRTG NVVAGAIRAL ATFTMSYQ                               338
//

If you have problems or comments...

PBIL Back to PBIL home page